PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_002372
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family CPP
Protein Properties Length: 766aa    MW: 84320.2 Da    PI: 5.5525
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_002372genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.24.3e-15478516240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+C+CkkskClk+YCeCfaag +C e C C++C+Nk 
  DCAR_002372 478 SCKRCKCKKSKCLKLYCECFAAGLYCVEPCACHECFNKP 516
                  689**********************************96 PP

2TCR49.49.1e-16563602140
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+gCnCkks C kkYCeCf+ g+ Cs +C+Ce+CkN+ 
  DCAR_002372 563 RHKRGCNCKKSGCTKKYCECFQGGVGCSINCRCEQCKNTF 602
                  589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.7E-15477518IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.577478603IPR005172CRC domain
PfamPF036389.4E-11480515IPR005172CRC domain
SMARTSM011142.2E-16563604IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.2E-11565601IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MGDDDGVGLE RESEDVDATE AGDVATDTPQ RKQINTPVSN FEESPVFNYL NNLSPIAGVR  60
SVHITQTYNS LNLASLPSVF TSPHVSTIKD SKFLRRHHLR DPSKLEFSSE NVNKASKQQE  120
VAGIFDDSSE VQNFSPVSAS SKPPHLPNEL SRTVTYEPVN LDSDVALCSR ELDSGICQIG  180
SEINIEGESH IDEEKEVSDC DWNNLLSDEG GLSIFESPID SKSLNDPSQK SHEAGMSFRT  240
SLFDDLPKNL AIQAVEPCQL SETDDMSFQH KESNMNEIAE NHDLLVSLSS EAGDTNEIVD  300
GELASNIQRG LRRRCLLFEM TGSRRKPLTD ISNVGPITLS HSHDNILSND KCLVPNKPKH  360
DIRRCNLSGI GLHLNALAST SVNHKVGKYE ELNTDKQPLS VFPSAVCLNP SNRQEQQKDS  420
LVASSSEMDM LPAGEYISLV EDAGQASEDV LNEELVDNSA KKKRHVWQKV ESGGEGESCK  480
RCKCKKSKCL KLYCECFAAG LYCVEPCACH ECFNKPIHEE NVLAARNQIE SRNPLAFAPK  540
VIRSSESMID VGEESGKTPA SARHKRGCNC KKSGCTKKYC ECFQGGVGCS INCRCEQCKN  600
TFGRKHGSSY IRMEVELEKD VEGEACESVI EKNLQIRTVQ NGAEQNTRFG LPETPLPSDR  660
QLIAPPLSSK SMRPPRSTFL AVESSSQEFG KLNRSQSKFK KHINAQEDEM SENLQPIMGD  720
VQSDSPNSKR ASPLHGKAGF TPGLRSSRKL ILQSIPSFPS LTPKH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010649949.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLF6HDS90.0F6HDS9_VITVI; Putative uncharacterized protein
STRINGVIT_05s0020g03880.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-110Tesmin/TSO1-like CXC domain-containing protein